PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00102g00931.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family HD-ZIP
Protein Properties Length: 246aa    MW: 28007.5 Da    PI: 6.1028
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00102g00931.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.61.2e-19128182256
                               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               rk+ ++tk+q  +Lee F+++++++ ++++ LAk+lgL  rqV vWFqNrRa+ k
  Peaxi162Scf00102g00931.1 128 RKKLRLTKDQSAVLEESFKEHNTLNPKQKQALAKRLGLRPRQVEVWFQNRRARTK 182
                               78889************************************************98 PP

2HD-ZIP_I/II129.51.3e-41128217191
               HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeve 85 
                               +kk+rl+k+q+++LEesF+e+++L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+
  Peaxi162Scf00102g00931.1 128 RKKLRLTKDQSAVLEESFKEHNTLNPKQKQALAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQ 212
                               69*********************************************************************************** PP

               HD-ZIP_I/II  86 eLreel 91 
                               eLr +l
  Peaxi162Scf00102g00931.1 213 ELR-AL 217
                               **9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.3E-291105IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.601.3E-18119178IPR009057Homeodomain-like
SuperFamilySSF466896.68E-19120185IPR009057Homeodomain-like
PROSITE profilePS5007117.702124184IPR001356Homeobox domain
SMARTSM003895.4E-17126188IPR001356Homeobox domain
CDDcd000861.02E-15128185No hitNo description
PfamPF000464.5E-17128182IPR001356Homeobox domain
PRINTSPR000311.1E-5155164IPR000047Helix-turn-helix motif
PROSITE patternPS000270159182IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5164180IPR000047Helix-turn-helix motif
PfamPF021831.7E-11184218IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.2E-27184227IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009641Biological Processshade avoidance
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009826Biological Processunidimensional cell growth
GO:0010016Biological Processshoot system morphogenesis
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010218Biological Processresponse to far red light
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MENQDLGLSL SLSFPENRTT ANNPLQLNLM PSLASSTSPF NLFQKTSWTD SFPSSDRNLE  60
TCRTFLKGID VNRVPTTTDV EEEAGVSSPN STISSLSGNK RSEREANCEE LDMDTRGISD  120
EEDGETSRKK LRLTKDQSAV LEESFKEHNT LNPKQKQALA KRLGLRPRQV EVWFQNRRAR  180
TKLKQTEVDC EFLKRCCENL TEENRRLQKE VQELRALKLS PQFYMQMTPP TTLTMCPSCE  240
RVAAPP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126132SRKKLRL
2176184RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009590186.11e-147PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotQ054661e-104HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLM1CHH01e-135M1CHH0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000675401e-134(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.11e-106homeobox protein 2